PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA102G00071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family HRT-like
Protein Properties Length: 433aa    MW: 48961.9 Da    PI: 9.2459
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA102G00071genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like56.74e-18233263131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  +CGviledG  C+++PvkgRKRC eHKG+Ri
  AA102G00071 233 VCGVILEDGGSCNETPVKGRKRCIEHKGQRI 263
                  7*****************************7 PP

2HRT-like48.31.7e-15285315131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  iCGvil d  +C ++P++gRKRCe HKGmRi
  AA102G00071 285 ICGVILPDMKPCGNKPAPGRKRCEDHKGMRI 315
                  8*****************************7 PP

3HRT-like57.52.2e-18401431131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  +CGv+l +G vC+r+PvkgRKRCeeHKGmRi
  AA102G00071 401 TCGVKLCNGFVCERSPVKGRKRCEEHKGMRI 431
                  7*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGYGGDDFPF AVVPTVFKRE DYKRTKHDAV FSKWQILIGS KDWEDFKDGK DGVGRYRVQN  60
LPSKSFPGLY ELGVAVTSEV HGRKLEVDDV LVSYLGQAEN VRSRLQSYGR SGAHLRNVNY  120
NESLDKKSVT SSLFEDIFSN GGSILYRWAP MRSKREAEAT EGMLLCTFDY AWNKGSNGER  180
RELDLLRKLG NGEFMNQRKS EISRVLFPFL KNQVGIEVKG EKHVLKEERY SSVCGVILED  240
GGSCNETPVK GRKRCIEHKG QRICRVSPEK QRSKKPEIYI DSDVICGVIL PDMKPCGNKP  300
APGRKRCEDH KGMRINAFLF LLNSQDLNKT VKDEKFDTIT HLEVNEGEAL SRFCEAITKS  360
GLPCTRNSPK GSKRCWQHRE KISDVESSET VSPVTVKVVV TCGVKLCNGF VCERSPVKGR  420
KRCEEHKGMR IVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866167.10.0hypothetical protein ARALYDRAFT_918835
SwissprotF4K9330.0ET2_ARATH; Protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLD7MM690.0D7MM69_ARALL; Putative uncharacterized protein
STRINGscaffold_802235.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.10.0effector of transcription2